Recombinant Human TRPV3

Cat.No. : TRPV3-28682TH
Product Overview : Recombinant fragment corresponding to amino acids 681-790 of Human TRPV3 with a proprietary tag at N-terminal; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member (TRPV1) gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Sequence Similarities : Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily.Contains 3 ANK repeats.
Gene Name TRPV3 transient receptor potential cation channel, subfamily V, member 3 [ Homo sapiens ]
Official Symbol TRPV3
Synonyms TRPV3; transient receptor potential cation channel, subfamily V, member 3; transient receptor potential cation channel subfamily V member 3; VRL3;
Gene ID 162514
mRNA Refseq NM_145068
Protein Refseq NP_659505
MIM 607066
Uniprot ID Q8NET8
Chromosome Location 17p13.3
Function calcium channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPV3 Products

Required fields are marked with *

My Review for All TRPV3 Products

Required fields are marked with *

0
cart-icon