| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Wheat Germ | 
                                
                                
                                    | Tag : | 
                                    Non | 
                                
                                
                                    | Protein Length : | 
                                    110 amino acids | 
                                
                                
                                    | Description : | 
                                    This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member (TRPV1) gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. | 
                                
                                
                                    | Molecular Weight : | 
                                    37.730kDa inclusive of tags | 
                                
                                
                                    | Tissue specificity : | 
                                    Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level). | 
                                
                                
                                    | Form : | 
                                    Liquid | 
                                
                                
                                    | Purity : | 
                                    Proprietary Purification | 
                                
                                
                                    | Storage buffer : | 
                                    pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione | 
                                
                                
                                    | Storage : | 
                                    Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
                                
                                
                                    | Sequences of amino acids : | 
                                    VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV | 
                                
                                
                                    | Sequence Similarities : | 
                                    Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily.Contains 3 ANK repeats. |