Recombinant Human TRPV3
Cat.No. : | TRPV3-28682TH |
Product Overview : | Recombinant fragment corresponding to amino acids 681-790 of Human TRPV3 with a proprietary tag at N-terminal; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member (TRPV1) gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV |
Sequence Similarities : | Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily.Contains 3 ANK repeats. |
Gene Name | TRPV3 transient receptor potential cation channel, subfamily V, member 3 [ Homo sapiens ] |
Official Symbol | TRPV3 |
Synonyms | TRPV3; transient receptor potential cation channel, subfamily V, member 3; transient receptor potential cation channel subfamily V member 3; VRL3; |
Gene ID | 162514 |
mRNA Refseq | NM_145068 |
Protein Refseq | NP_659505 |
MIM | 607066 |
Uniprot ID | Q8NET8 |
Chromosome Location | 17p13.3 |
Function | calcium channel activity; |
◆ Recombinant Proteins | ||
TRPV3-348H | Recombinant Human TRPV3 Protein, His-tagged | +Inquiry |
TRPV3-17462M | Recombinant Mouse TRPV3 Protein | +Inquiry |
TRPV3-1176HFL | Recombinant Human TRPV3 protein, His&Flag-tagged | +Inquiry |
TRPV3-035H | Recombinant Human TRPV3 Full Length Transmembrane protein, His-Flag-tagged | +Inquiry |
RFL15590MF | Recombinant Full Length Mouse Transient Receptor Potential Cation Channel Subfamily V Member 3(Trpv3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPV3-732HCL | Recombinant Human TRPV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPV3 Products
Required fields are marked with *
My Review for All TRPV3 Products
Required fields are marked with *
0
Inquiry Basket