Recombinant Human TTC3, His-tagged
| Cat.No. : | TTC3-31249TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1870-2025 of Human TTC3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1870-2025 a.a. |
| Description : | Tetratricopeptide repeat protein 3 is a protein that in humans is encoded by the TTC3 gene. |
| Conjugation : | HIS |
| Tissue specificity : | Found in all tissues examined. |
| Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VRSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDK RTYEPSSATPVTRSSQGSPSVVVAPSPKTKGQKAEDVP VRIALGASSCEICHEVFKSKNVRVLKCGHKYHKGCFKQ WLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCS SR |
| Sequence Similarities : | Contains 1 RING-type zinc finger.Contains 4 TPR repeats. |
| Gene Name | TTC3 tetratricopeptide repeat domain 3 [ Homo sapiens ] |
| Official Symbol | TTC3 |
| Synonyms | TTC3; tetratricopeptide repeat domain 3; E3 ubiquitin-protein ligase TTC3; DCRR1; RNF105; TPRD; TPRDI; TPRDII; TPRDIII; |
| Gene ID | 7267 |
| mRNA Refseq | NM_003316 |
| Protein Refseq | NP_003307 |
| MIM | 602259 |
| Uniprot ID | P53804 |
| Chromosome Location | 21q22.2 |
| Function | ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| TTC3-31249TH | Recombinant Human TTC3, His-tagged | +Inquiry |
| TTC3-3473H | Recombinant Human TTC3, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTC3 Products
Required fields are marked with *
My Review for All TTC3 Products
Required fields are marked with *
