Recombinant Human TTC3, His-tagged
| Cat.No. : | TTC3-31249TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1870-2025 of Human TTC3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Tetratricopeptide repeat protein 3 is a protein that in humans is encoded by the TTC3 gene. |
| Conjugation : | HIS |
| Source : | E. coli |
| Tissue specificity : | Found in all tissues examined. |
| Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VRSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDK RTYEPSSATPVTRSSQGSPSVVVAPSPKTKGQKAEDVP VRIALGASSCEICHEVFKSKNVRVLKCGHKYHKGCFKQ WLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCS SR |
| Sequence Similarities : | Contains 1 RING-type zinc finger.Contains 4 TPR repeats. |
| Gene Name : | TTC3 tetratricopeptide repeat domain 3 [ Homo sapiens ] |
| Official Symbol : | TTC3 |
| Synonyms : | TTC3; tetratricopeptide repeat domain 3; E3 ubiquitin-protein ligase TTC3; DCRR1; RNF105; TPRD; TPRDI; TPRDII; TPRDIII; |
| Gene ID : | 7267 |
| mRNA Refseq : | NM_003316 |
| Protein Refseq : | NP_003307 |
| MIM : | 602259 |
| Uniprot ID : | P53804 |
| Chromosome Location : | 21q22.2 |
| Function : | ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; |
Products Types
| ◆ Recombinant Protein | ||
| TTC3-3473H | Recombinant Human TTC3, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
