Recombinant Human TXNDC5 Protein, His-tagged
| Cat.No. : | TXNDC5-30130TH |
| Product Overview : | Recombinant Human TXNDC5 Protein was expressed in E. coli with His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | C-324aa |
| AA sequence : | CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Storage buffer : | 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) |
| Gene Name | TXNDC5 thioredoxin domain containing 5 [ Homo sapiens (human) ] |
| Official Symbol | TXNDC5 |
| Synonyms | TXNDC5; thioredoxin domain containing 5 (endoplasmic reticulum); thioredoxin domain containing 5; thioredoxin domain-containing protein 5; EndoPDI; ERp46; FLJ21353; FLJ90810; Hcc 2; MGC3178; PDIA15; protein disulfide isomerase family A; member 15; ER protein 46; thioredoxin related protein; thioredoxin-like protein p46; endoplasmic reticulum protein ERp46; endothelial protein disulphide isomerase; endoplasmic reticulum resident protein 46; protein disulfide isomerase family A, member 15; ERP46; HCC-2; STRF8; UNQ364; ENDOPDI; FLJ21789 |
| Gene ID | 81567 |
| mRNA Refseq | NM_030810.4 |
| Protein Refseq | NP_110437 |
| MIM | 616412 |
| UniProt ID | Q8NBS9 |
| ◆ Recombinant Proteins | ||
| TXNDC5-3501H | Recombinant Human TXNDC5, GST-tagged | +Inquiry |
| TXNDC5-3745HF | Recombinant Full Length Human TXNDC5 Protein, GST-tagged | +Inquiry |
| TXNDC5-4466H | Recombinant Human TXNDC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TXNDC5-1517C | Recombinant Chicken TXNDC5 | +Inquiry |
| TXNDC5-6615H | Recombinant Human TXNDC5 Protein (Met1-Leu432), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNDC5-622HCL | Recombinant Human TXNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC5 Products
Required fields are marked with *
My Review for All TXNDC5 Products
Required fields are marked with *
