Recombinant Human TXNDC5 Protein, His-tagged

• Cat.No.: TXNDC5-30130TH
• Product Overview: Recombinant Human TXNDC5 Protein was expressed in E. coli with His-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: C-324aa
• AA sequence: CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Storage buffer: 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. )

Gene Information

• Gene Name: TXNDC5 thioredoxin domain containing 5 [ Homo sapiens (human) ]
• Official Symbol: TXNDC5
• Synonyms: TXNDC5; thioredoxin domain containing 5 (endoplasmic reticulum); thioredoxin domain containing 5; thioredoxin domain-containing protein 5; EndoPDI; ERp46; FLJ21353; FLJ90810; Hcc 2; MGC3178; PDIA15; protein disulfide isomerase family A; member 15; ER protein 46; thioredoxin related protein; thioredoxin-like protein p46; endoplasmic reticulum protein ERp46; endothelial protein disulphide isomerase; endoplasmic reticulum resident protein 46; protein disulfide isomerase family A, member 15; ERP46; HCC-2; STRF8; UNQ364; ENDOPDI; FLJ21789
• Gene ID: 81567
• mRNA Refseq: NM_030810.4
• Protein Refseq: NP_110437
• MIM: 616412
• UniProt ID: Q8NBS9