"TXNL4B" Related Products

Expand

Recombinant Human TXNL4B, His-tagged

Cat.No.: TXNL4B-31638TH
Product Overview: Recombinant full length Human TXNL4B with an N terminal His tag; 185 amino acids with tag, MWt 21.1 kDa.
Description: Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene.
Protein length: 149 amino acids
Conjugation: HIS
Molecular Weight: 21.100kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Sequence Similarities: Belongs to the DIM1 family.
Gene Name: TXNL4B thioredoxin-like 4B [ Homo sapiens ]
Official Symbol: TXNL4B
Synonyms: TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511;
Gene ID: 54957
mRNA Refseq: NM_017853
Protein Refseq: NP_060323
Uniprot ID: Q9NX01
Chromosome Location: 16q22.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.