Recombinant Human UHRF1

• Cat.No.: UHRF1-31665TH
• Product Overview: Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
• Biological activity: This product is useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
• Sequence Similarities: Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain.

Gene Information

• Gene Name: UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ]
• Official Symbol: UHRF1
• Synonyms: UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106
• Gene ID: 29128
• mRNA Refseq: NM_001048201
• Protein Refseq: NP_001041666
• MIM: 607990
• Uniprot ID: Q96T88
• Chromosome Location: 19p13.3
• Function: DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding