"UHRF1" Related Products

Expand
Expand

Recombinant Human UHRF1

Cat.No.: UHRF1-31665TH
Product Overview: Recombinant fragment corresponding to aa 694-793 of human UHRF1 with a proprietary tag; 36.63kDa inclusive of tag.
Description: This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer.
Biological activity: This product is useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Sequence Similarities: Contains 1 PHD-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain.Contains 1 YDG domain.
Gene Name: UHRF1 ubiquitin-like with PHD and ring finger domains 1 [ Homo sapiens ]
Official Symbol: UHRF1
Synonyms: UHRF1; ubiquitin-like with PHD and ring finger domains 1; E3 ubiquitin-protein ligase UHRF1; FLJ21925; ICBP90; Np95; RNF106;
Gene ID: 29128
mRNA Refseq: NM_001048201
Protein Refseq: NP_001041666
MIM: 607990
Uniprot ID: Q96T88
Chromosome Location: 19p13.3
Function: DNA binding; core promoter proximal region sequence-specific DNA binding; ligase activity; metal ion binding; methyl-CpG binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.