Recombinant Human URM1, His-tagged

Cat.No. : URM1-31676TH
Product Overview : Recombinant full length Human Urm1 with N terminal His tag; 121 amino acids with tag, MWt 13.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 101 amino acids
Description : Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3.
Conjugation : HIS
Molecular Weight : 13.500kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
Sequence Similarities : Belongs to the URM1 family.
Gene Name URM1 ubiquitin related modifier 1 [ Homo sapiens ]
Official Symbol URM1
Synonyms URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668;
Gene ID 81605
mRNA Refseq NM_001135947
Protein Refseq NP_001129419
MIM 612693
Uniprot ID Q9BTM9
Chromosome Location 9q34.13
Pathway Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem;
Function protein binding; contributes_to sulfurtransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All URM1 Products

Required fields are marked with *

My Review for All URM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon