"URM1" Related Products

Expand

Recombinant Human URM1, His-tagged

Cat.No.: URM1-31676TH
Product Overview: Recombinant full length Human Urm1 with N terminal His tag; 121 amino acids with tag, MWt 13.5 kDa.
Description: Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3.
Protein length: 101 amino acids
Conjugation: HIS
Molecular Weight: 13.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
Sequence Similarities: Belongs to the URM1 family.
Gene Name: URM1 ubiquitin related modifier 1 [ Homo sapiens ]
Official Symbol: URM1
Synonyms: URM1; ubiquitin related modifier 1; C9orf74, chromosome 9 open reading frame 74 , ubiquitin related modifier 1 homolog (S. cerevisiae); ubiquitin-related modifier 1 homolog; MGC2668;
Gene ID: 81605
mRNA Refseq: NM_001135947
Protein Refseq: NP_001129419
MIM: 612693
Uniprot ID: Q9BTM9
Chromosome Location: 9q34.13
Pathway: Sulfur relay system, organism-specific biosystem; Sulfur relay system, conserved biosystem;
Function: protein binding; contributes_to sulfurtransferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.