"WSB1" Related Products

Expand

Recombinant Human WSB1, His-tagged

Cat.No.: WSB1-31528TH
Product Overview: Recombinant fragment, corresponding to amino acids 26-242 of Human WSB1 with N terminal His tag; MWt 25kDa.
Description: This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQ CLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHI IDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQL LLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFA PDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS CAFSPDSSMLCSVGASKAVFLWN
Gene Name: WSB1 WD repeat and SOCS box containing 1 [ Homo sapiens ]
Official Symbol: WSB1
Synonyms: WSB1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing protein 1; DKFZp564A122; DKFZp564B0482; SWIP1;
Gene ID: 26118
mRNA Refseq: NM_015626
Protein Refseq: NP_056441
MIM: 610091
Uniprot ID: Q9Y6I7
Chromosome Location: 17q11.2
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.