Recombinant Human WSB1, His-tagged
| Cat.No. : | WSB1-31528TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 26-242 of Human WSB1 with N terminal His tag; MWt 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-242 a.a. |
| Description : | This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQ CLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHI IDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQL LLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFA PDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS CAFSPDSSMLCSVGASKAVFLWN |
| Gene Name | WSB1 WD repeat and SOCS box containing 1 [ Homo sapiens ] |
| Official Symbol | WSB1 |
| Synonyms | WSB1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing protein 1; DKFZp564A122; DKFZp564B0482; SWIP1; |
| Gene ID | 26118 |
| mRNA Refseq | NM_015626 |
| Protein Refseq | NP_056441 |
| MIM | 610091 |
| Uniprot ID | Q9Y6I7 |
| Chromosome Location | 17q11.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| WSB1-5221R | Recombinant Rhesus monkey WSB1 Protein, His-tagged | +Inquiry |
| WSB1-976H | Recombinant Human WSB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| WSB1-6435C | Recombinant Chicken WSB1 | +Inquiry |
| WSB1-10034Z | Recombinant Zebrafish WSB1 | +Inquiry |
| WSB1-31528TH | Recombinant Human WSB1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WSB1-281HCL | Recombinant Human WSB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WSB1 Products
Required fields are marked with *
My Review for All WSB1 Products
Required fields are marked with *
