Recombinant Human WSB1, His-tagged
Cat.No. : | WSB1-31528TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-242 of Human WSB1 with N terminal His tag; MWt 25kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQ CLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHI IDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQL LLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFA PDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS CAFSPDSSMLCSVGASKAVFLWN |
Gene Name : | WSB1 WD repeat and SOCS box containing 1 [ Homo sapiens ] |
Official Symbol : | WSB1 |
Synonyms : | WSB1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing protein 1; DKFZp564A122; DKFZp564B0482; SWIP1; |
Gene ID : | 26118 |
mRNA Refseq : | NM_015626 |
Protein Refseq : | NP_056441 |
MIM : | 610091 |
Uniprot ID : | Q9Y6I7 |
Chromosome Location : | 17q11.2 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
WSB1-5034R | Recombinant Rhesus Macaque WSB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Wsb1-7011M | Recombinant Mouse Wsb1 Protein, Myc/DDK-tagged | +Inquiry |
WSB1-6435C | Recombinant Chicken WSB1 | +Inquiry |
WSB1-10034Z | Recombinant Zebrafish WSB1 | +Inquiry |
WSB1-3742H | Recombinant Human WSB1, GST-tagged | +Inquiry |
◆ Lysates | ||
WSB1-281HCL | Recombinant Human WSB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket