Recombinant Human WSB1, His-tagged
Cat.No. : | WSB1-31528TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-242 of Human WSB1 with N terminal His tag; MWt 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-242 a.a. |
Description : | This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQ CLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHI IDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQL LLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFA PDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS CAFSPDSSMLCSVGASKAVFLWN |
Gene Name | WSB1 WD repeat and SOCS box containing 1 [ Homo sapiens ] |
Official Symbol | WSB1 |
Synonyms | WSB1; WD repeat and SOCS box containing 1; WD repeat and SOCS box-containing protein 1; DKFZp564A122; DKFZp564B0482; SWIP1; |
Gene ID | 26118 |
mRNA Refseq | NM_015626 |
Protein Refseq | NP_056441 |
MIM | 610091 |
Uniprot ID | Q9Y6I7 |
Chromosome Location | 17q11.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
WSB1-3742H | Recombinant Human WSB1, GST-tagged | +Inquiry |
WSB1-5034R | Recombinant Rhesus Macaque WSB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Wsb1-7011M | Recombinant Mouse Wsb1 Protein, Myc/DDK-tagged | +Inquiry |
WSB1-976H | Recombinant Human WSB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WSB1-10034Z | Recombinant Zebrafish WSB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WSB1-281HCL | Recombinant Human WSB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WSB1 Products
Required fields are marked with *
My Review for All WSB1 Products
Required fields are marked with *