Recombinant Human ZNF131, His-tagged

• Cat.No.: ZNF131-30754TH
• Product Overview: Recombinant fragment, corresponding to amino acids 444-589 of Human ZNF131 Isoform 2 with N terminal His tag;Predicted MWt 18 kDa.

Specification

• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Predominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus.
• Form: Lyophilised:Reconstitute with 135 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELP EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEV QTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHE DAEDLETKPTVDSEAEKAENEDRTALPVLE
• Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 6 C2H2-type zinc fingers.

Gene Information

• Gene Name: ZNF131 zinc finger protein 131 [ Homo sapiens ]
• Official Symbol: ZNF131
• Synonyms: ZNF131; zinc finger protein 131; zinc finger protein 131 (clone pHZ 10); pHZ 10
• Gene ID: 7690
• mRNA Refseq: NM_003432
• Protein Refseq: NP_003423
• MIM: 604073
• Uniprot ID: P52739
• Chromosome Location: 5p12
• Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding