Recombinant Human ZNF131, His-tagged

Cat.No. : ZNF131-30754TH
Product Overview : Recombinant fragment, corresponding to amino acids 444-589 of Human ZNF131 Isoform 2 with N terminal His tag;Predicted MWt 18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 444-589 a.a.
Conjugation : HIS
Tissue specificity : Predominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus.
Form : Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELP EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEV QTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHE DAEDLETKPTVDSEAEKAENEDRTALPVLE
Sequence Similarities : Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 6 C2H2-type zinc fingers.
Gene Name ZNF131 zinc finger protein 131 [ Homo sapiens ]
Official Symbol ZNF131
Synonyms ZNF131; zinc finger protein 131; zinc finger protein 131 (clone pHZ 10); pHZ 10;
Gene ID 7690
mRNA Refseq NM_003432
Protein Refseq NP_003423
MIM 604073
Uniprot ID P52739
Chromosome Location 5p12
Function DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF131 Products

Required fields are marked with *

My Review for All ZNF131 Products

Required fields are marked with *

0
cart-icon