"ZNF131" Related Products

Recombinant Human ZNF131, His-tagged

Cat.No.: ZNF131-30754TH
Product Overview: Recombinant fragment, corresponding to amino acids 444-589 of Human ZNF131 Isoform 2 with N terminal His tag;Predicted MWt 18 kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Predominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus.
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELP EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEV QTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHE DAEDLETKPTVDSEAEKAENEDRTALPVLE
Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 6 C2H2-type zinc fingers.
Gene Name: ZNF131 zinc finger protein 131 [ Homo sapiens ]
Official Symbol: ZNF131
Synonyms: ZNF131; zinc finger protein 131; zinc finger protein 131 (clone pHZ 10); pHZ 10;
Gene ID: 7690
mRNA Refseq: NM_003432
Protein Refseq: NP_003423
MIM: 604073
Uniprot ID: P52739
Chromosome Location: 5p12
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.