Recombinant Human ZNF131, His-tagged
Cat.No. : | ZNF131-30754TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 444-589 of Human ZNF131 Isoform 2 with N terminal His tag;Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 444-589 a.a. |
Conjugation : | HIS |
Tissue specificity : | Predominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus. |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VHVLPLLQVQVDSAQVTVEQVHPDLLQDSQVHDSHMSELP EQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEV QTELLEADLDHVTPEIMNQEERESSQADAAEAAREDHE DAEDLETKPTVDSEAEKAENEDRTALPVLE |
Sequence Similarities : | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 6 C2H2-type zinc fingers. |
Gene Name | ZNF131 zinc finger protein 131 [ Homo sapiens ] |
Official Symbol | ZNF131 |
Synonyms | ZNF131; zinc finger protein 131; zinc finger protein 131 (clone pHZ 10); pHZ 10; |
Gene ID | 7690 |
mRNA Refseq | NM_003432 |
Protein Refseq | NP_003423 |
MIM | 604073 |
Uniprot ID | P52739 |
Chromosome Location | 5p12 |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
ZNF131-3644H | Recombinant Human ZNF131 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZFP131-18830M | Recombinant Mouse ZFP131 Protein | +Inquiry |
ZNF131-10398M | Recombinant Mouse ZNF131 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF131-30754TH | Recombinant Human ZNF131, His-tagged | +Inquiry |
ZNF131-10799Z | Recombinant Zebrafish ZNF131 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF131-1985HCL | Recombinant Human ZNF131 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF131 Products
Required fields are marked with *
My Review for All ZNF131 Products
Required fields are marked with *