| Cat.No.: | IL19-4332HG |
| Product Overview: | Recombinant Human IL19 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
| Description: | Human Interleukin-19 (IL-19) is encoded by the IL19 gene, which is located on the chromosome 1. The protein belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis. |
| Source: | E. coli |
| Species: | Human |
| Form: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity: | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10^5 IU/mg. |
| Molecular Mass: | Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| AA Sequence: | LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA |
| Endotoxin: | Less than 1 EU/µg of rHuIL-19 as determined by LAL method. |
| Purity: | > 95 % by SDS-PAGE and HPLC analyses. |
| Storage: | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Reconstitution: | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Quality Statement: | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
| Shipping: | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name: | IL19 interleukin 19 [ Homo sapiens (human) ] |
| Official Symbol: | IL19 |
| Synonyms: | MDA1; NG.1; ZMDA1; IL-10C; Melanoma Differentiation-associated Protein-like Protein, NG.1 |
| Gene ID: | 29949 |
| mRNA Refseq: | NM_153758.2 |
| Protein Refseq: | NP_715639.1 |
| MIM: | 605687 |
| UniProt ID: | Q9UHD0 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All IL19 Products
Download Datasheet