| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
Human Interleukin-19 (IL-19) is encoded by the IL19 gene, which is located on the chromosome 1. The protein belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis. |
| Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10^5 IU/mg. |
| Molecular Mass : |
Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| AA Sequence : |
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA |
| Endotoxin : |
Less than 1 EU/µg of rHuIL-19 as determined by LAL method. |
| Purity : |
> 95 % by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Reconstitution : |
Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Quality Statement : |
Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
| Shipping : |
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
