Native Human ALB therapeutic protein (Albumin iodinated I-131 serum)

Cat.No. : ALB-P042H
Product Overview : A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Molecular Mass : 66.5 kDa
AA Sequence : MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVT EFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRP EVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEG KASSAKQGLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFL YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQL GEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVFLNQLCVLHEKTPV SDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Alias : ALB; PRO0883; PRO0903; Albumin iodinated I-131 serum
Gene Name ALB albumin [ Homo sapiens ]
Official Symbol ALB
Synonyms ALB; albumin; serum albumin; albumin (32 AA); albumin (AA 34); growth-inhibiting protein 20; cell growth inhibiting protein 42; PRO0883; PRO0903; PRO1341; DKFZp779N1935;
Gene ID 213
mRNA Refseq NM_000477
Protein Refseq NP_000468
UniProt ID P02768
Chromosome Location 4q13.3
Pathway Bile acid and bile salt metabolism, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function DNA binding; antioxidant activity; cell surface binding; chaperone binding; copper ion binding; drug binding; drug binding; enzyme binding; fatty acid binding; fatty acid binding; metal ion binding; contributes_to oxygen binding; protein binding; pyridoxal phosphate binding; toxin binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALB Products

Required fields are marked with *

My Review for All ALB Products

Required fields are marked with *

0
cart-icon
0
compare icon