Native Human ALB therapeutic protein (Albumin iodinated I-131 serum)

• Cat.No.: ALB-P042H
• Product Overview: A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times

Specification

• Species: Human
• Tag: Non
• Description: Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
• Molecular Mass: 66.5 kDa
• AA Sequence: MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVT EFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRP EVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEG KASSAKQGLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFL YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQL GEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVFLNQLCVLHEKTPV SDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV
• Endotoxin: < 0.1 EU per μg of the protein
• Purity: >95%
• Alias: ALB; PRO0883; PRO0903; Albumin iodinated I-131 serum

Gene Information

• Gene Name: ALB albumin [ Homo sapiens ]
• Official Symbol: ALB
• Synonyms: ALB; albumin; serum albumin; albumin (32 AA); albumin (AA 34); growth-inhibiting protein 20; cell growth inhibiting protein 42; PRO0883; PRO0903; PRO1341; DKFZp779N1935
• Gene ID: 213
• mRNA Refseq: NM_000477
• Protein Refseq: NP_000468
• UniProt ID: P02768
• Chromosome Location: 4q13.3
• Pathway: Bile acid and bile salt metabolism, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: DNA binding; antioxidant activity; cell surface binding; chaperone binding; copper ion binding; drug binding; drug binding; enzyme binding; fatty acid binding; fatty acid binding; metal ion binding; contributes_to oxygen binding; protein binding; pyridoxal phosphate binding; toxin binding; zinc ion binding