Recombinant Aequorea victoria Aequorin Protein

Cat.No. : Aequorin-154
Product Overview : Recombinant Aequorea victoria Aequorin was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Aequorea victoria
Source : E.coli
Tag : Non
Description : Aequorin, a photoprotein originating from the jellyfish Aequorea victoria emits light in the presence of a trace amount of Ca2+ without the requirement of any other cofactor. Aequorin was “charged” with unmodified (native) Coelenterazine and will emit light at 465 nm upon Ca2+ contact.
AA Sequence : MTSKQYSVKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Applications : postitive control in Ca2+ assays
Storage : The protein is shipped in liquid form at room temperature. Store at 4 centigrade for up to one month or freeze at -20 centigrade for longer time periods.
Concentration : 2 mg/ml in 1.2M (NH4)2SO4, 250 μl per tube.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Aequorin Products

Required fields are marked with *

My Review for All Aequorin Products

Required fields are marked with *

0
cart-icon