Recombinant Arabidopsis Thaliana MSRB7 Protein (1-144 aa), His-SUMO-tagged

• Cat.No.: MSRB7-2157A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) MSRB7 Protein (1-144 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Arabidopsis Thaliana
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-144 aa
• Description: Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.5 kDa
• AA Sequence: MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: MSRB7 methionine sulfoxide reductase B7 [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: MSRB7
• Synonyms: ATMSRB7; methionine sulfoxide reductase B7; T8O5.40; T8O5_40
• Gene ID: 828271
• mRNA Refseq: NM_118303
• Protein Refseq: NP_567637
• UniProt ID: Q8VY86