Recombinant Bordetella Bronchiseptica BB3856 Protein (22-150 aa), His-Myc-tagged
Cat.No. : | BB3856-2538B |
Product Overview : | Recombinant Bordetella Bronchiseptica (strain ATCC BAA-588/NCTC 13252/RB50) (Alcaligenes bronchisepticus) BB3856 Protein (22-150 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella Bronchiseptica |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 22-150 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.8 kDa |
AA Sequence : | AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | BB3856; |
UniProt ID | P0A321 |
◆ Recombinant Proteins | ||
BB3856-4149B | Recombinant Bordetella bronchiseptica BB3856 protein, His&Myc-tagged | +Inquiry |
BB3856-5694B | Recombinant Bordetella bronchiseptica BB3856 protein, His-sumostar-tagged | +Inquiry |
BB3856-2538B | Recombinant Bordetella Bronchiseptica BB3856 Protein (22-150 aa), His-Myc-tagged | +Inquiry |
BB3856-5693B | Recombinant Bordetella bronchiseptica BB3856 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BB3856 Products
Required fields are marked with *
My Review for All BB3856 Products
Required fields are marked with *