Recombinant Bordetella Bronchiseptica BB3856 Protein (22-150 aa), His-Myc-tagged

Cat.No. : BB3856-2538B
Product Overview : Recombinant Bordetella Bronchiseptica (strain ATCC BAA-588/NCTC 13252/RB50) (Alcaligenes bronchisepticus) BB3856 Protein (22-150 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bordetella Bronchiseptica
Source : Yeast
Tag : His&Myc
Protein Length : 22-150 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.8 kDa
AA Sequence : AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms BB3856;
UniProt ID P0A321

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BB3856 Products

Required fields are marked with *

My Review for All BB3856 Products

Required fields are marked with *

0
cart-icon