Recombinant Bovine SERPINA3-2 Protein (25-411 aa), His-tagged

Cat.No. : SERPINA3-2-1630B
Product Overview : Recombinant Bovine SERPINA3-2 Protein (25-411 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : Yeast
Tag : His
Protein Length : 25-411 aa
Description : Serine protease inhibitor.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 45.6 kDa
AA Sequence : LPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGVAATGIGIERTFLRIIVRVNRPFLIAVVLKDTQSIIFLGKVTNPSEA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name SERPINA3-2 SERPIN A3-2 [ Bos taurus (cattle) ]
Official Symbol SERPINA3-2
Synonyms SERPINA3-2;
Gene ID 100272170
mRNA Refseq NM_001146301
Protein Refseq NP_001139773
UniProt ID A2I7M9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINA3-2 Products

Required fields are marked with *

My Review for All SERPINA3-2 Products

Required fields are marked with *

0
cart-icon