Recombinant C. botulinum CBO3083 Protein, His-SUMO-tagged
| Cat.No. : | CBO3083-1320C |
| Product Overview : | Recombinant C. botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) CBO3083 Protein (663-830aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | C.botulinum |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 663-830 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 35.2 kDa |
| AA Sequence : | VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRR DYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNN NNNNDNNNNTKPPENDSNQNHEDNKNKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CBO3083 penicillin-binding protein, 1A family [ Clostridium botulinum A str. ATCC 3502 ] |
| Official Symbol | CBO3083 |
| Synonyms | CBO3083; pbpA; Penicillin-binding protein 1A; PBP1a; Penicillin-insensitive transglycosylase; Peptidoglycan Tgase; Penicillin-sensitive transpeptidase; DD-transpeptidase; EC 2.4.1.129; EC 3.4.16.4 |
| Gene ID | 5185759 |
| Protein Refseq | YP_001255575.1 |
| UniProt ID | A5I6G4 |
| ◆ Recombinant Proteins | ||
| CBO3083-1320C | Recombinant C. botulinum CBO3083 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBO3083 Products
Required fields are marked with *
My Review for All CBO3083 Products
Required fields are marked with *
