Recombinant Chicken EN1 Protein, His-B2M-tagged
| Cat.No. : | EN1-1199C |
| Product Overview : | Recombinant Chicken EN1 Protein (1-333aa) was expressed in E. coli with N-terminal His-B2M-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-333 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 48.5 kDa |
| AA Sequence : | MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | EN1 engrailed homeobox 1 [ Gallus gallus (chicken) ] |
| Official Symbol | EN1 |
| Synonyms | EN1; En-1; en-3; Gg-En-1; engrailed homeobox 1 |
| Gene ID | 771008 |
| mRNA Refseq | XM_001234328.4 |
| Protein Refseq | XP_001234329.4 |
| UniProt ID | Q05916 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EN1 Products
Required fields are marked with *
My Review for All EN1 Products
Required fields are marked with *



