Recombinant Cynomolgus monkey CD3E Protein, His and Fc-tagged

Cat.No. : CD3E-140C
Product Overview : Recombinant Cynomolgus monkey CD3E protein with His and Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : Fc&His
Protein Length : 198
Description : The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Form : Lyophilized
Molecular Mass : 38.3 kDa
AA Sequence : MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Macaca mulatta (Rhesus monkey) ]
Official Symbol CD3E
Synonyms CD3E; CD3e molecule, epsilon (CD3-TCR complex); T-cell surface glycoprotein CD3 epsilon chain;
Gene ID 699467
mRNA Refseq XM_015115816
Protein Refseq XP_014971302
UniProt ID G7NCB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3E Products

Required fields are marked with *

My Review for All CD3E Products

Required fields are marked with *

0
cart-icon
0
compare icon