Recombinant Cynomolgus monkey CD3E Protein, His and Fc-tagged
| Cat.No. : | CD3E-140C |
| Product Overview : | Recombinant Cynomolgus monkey CD3E protein with His and Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | 198 |
| Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
| Form : | Lyophilized |
| Molecular Mass : | 38.3 kDa |
| AA Sequence : | MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | CD3E |
| Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); T-cell surface glycoprotein CD3 epsilon chain; |
| Gene ID | 699467 |
| mRNA Refseq | XM_015115816 |
| Protein Refseq | XP_014971302 |
| UniProt ID | G7NCB9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *


