Recombinant Mouse CD3E Protein, Fc-tagged

Cat.No. : CD3E-144M
Product Overview : Recombinant Mouse CD3E protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 189
Description : Predicted to enable several functions, including SH3 domain binding activity; identical protein binding activity; and protein heterodimerization activity. Involved in nervous system development and positive regulation of cell adhesion. Acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction. Located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. Is expressed in colon and hemolymphoid system. Human ortholog(s) of this gene implicated in immunodeficiency 18. Orthologous to human CD3E (CD3e molecule).
Form : Lyophilized
Molecular Mass : 36 kDa
AA Sequence : MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Cd3e CD3 antigen, epsilon polypeptide [ Mus musculus (house mouse) ]
Official Symbol CD3E
Synonyms CD3E; CD3 antigen, epsilon polypeptide; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD3; T3e; AI504783; CD3epsilon;
Gene ID 12501
mRNA Refseq NM_007648
Protein Refseq NP_031674
UniProt ID P22646

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD3E Products

Required fields are marked with *

My Review for All CD3E Products

Required fields are marked with *

0
cart-icon
0
compare icon