"CMA1" Related Products

Expand
Expand

Recombinant Cynomolgus Monkey CMA1 Protein (22-247 aa), His-SUMO-tagged

Cat.No. : CMA1-2111C
Product Overview : Recombinant Cynomolgus Monkey CMA1 Protein (22-247 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Source : E. coli
Species : Cynomolgus Monkey
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 41.1 kDa
Protein length : 22-247 aa
AA Sequence : IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name : CMA1 chymase 1 [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol : CMA1
Synonyms : CMA1; Chymase;
Gene ID : 102128612
mRNA Refseq : NM_001285192
Protein Refseq : NP_001272121
UniProt ID : P56435

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.