Recombinant Cynomolgus Monkey IL21 Protein
| Cat.No. : | IL21-02C |
| Product Overview : | Recombinant Cynomolgus Monkey IL21 Protein was expressed in HEK293. |
| Availability | September 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | HEK293 |
| Description : | interleukin 21 |
| Form : | Lyophilized from sterile PBS, pH 7.4, 5 % trehalose, 5 % mannitol. |
| Molecular Mass : | ~18.6 kDa |
| AA Sequence : | MGWSCIILFLVATATGVHSHHHHHHGGGGSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Purity : | >90% as determined by SDS-PAGE |
| Storage : | Please prepare aliquots and store at -20 to 80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | IL21 interleukin 21 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | IL21 |
| Gene ID | 708125 |
| mRNA Refseq | NM_001194242.1 |
| Protein Refseq | NP_001181171.1 |
| UniProt ID | A0A2K5UL71 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Products
Required fields are marked with *
My Review for All Products
Required fields are marked with *
