Recombinant Dendra2 Protein, His-tagged
| Cat.No. : | Dendra2-314 |
| Product Overview : | Recombinant Dendra2 fused with His tag at N-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Form : | PBS, pH7.4, 10% glycerol. |
| Molecular Mass : | 27.5 kDa |
| AA Sequence : | MRGSGSMNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVWSGDSGVYK |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | >50 ug/mL as determined by microplate BCA method |
| ◆ Recombinant Proteins | ||
| Dendra2-314 | Recombinant Dendra2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dendra2 Products
Required fields are marked with *
My Review for All Dendra2 Products
Required fields are marked with *
