Recombinant Drosophila Melanogaster PBURS Protein (21-141 aa), His-tagged

• Cat.No.: PBURS-1733D
• Product Overview: Recombinant Drosophila Melanogaster (Fruit fly) PBURS Protein (21-141 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Drosophila
• Source: Yeast
• Tag: His
• Protein Length: 21-141 aa
• Description: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.8 kDa
• AA Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Pburs Partner of Bursicon [ Drosophila melanogaster (fruit fly) ]
• Official Symbol: PBURS
• Synonyms: A; Bur beta; burs beta; Burs beta; burs-beta; bursbeta; Bursbeta; CG15284; Dmel\CG15284; pads-b; pburs; PBURS; pu; pup
• Gene ID: 34845
• mRNA Refseq: NM_135868
• Protein Refseq: NP_609712
• UniProt ID: Q9VJS7