Recombinant Drosophila Melanogaster TRX-2 Protein (1-114 aa), His-SUMO-tagged

Cat.No. : TRX2-1877D
Product Overview : Recombinant Drosophila Melanogaster (Fruit fly) TRX-2 Protein (1-114 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Drosophila
Source : E.coli
Tag : His&SUMO
Protein Length : 1-114 aa
Description : Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. As a reducing substrate of peroxiredoxin 1, thioredoxin 2 is preferred over thioredoxin 1.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.7 kDa
AA Sequence : MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Trx-2 thioredoxin-2 [ Drosophila melanogaster (fruit fly) ]
Official Symbol TRX-2
Synonyms 31884; anon-WO0118547.188; CG31884; CG3864; DmelTrx-2; Dmel\CG31884; dmtrx-2; DmTrx-2; DTrx-2; Trx; trx-2; Trx2; TRX2;
Gene ID 34281
mRNA Refseq NM_164863
Protein Refseq NP_723475
UniProt ID Q9V429

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRX-2 Products

Required fields are marked with *

My Review for All TRX-2 Products

Required fields are marked with *

0
cart-icon