Recombinant Drosophila Melanogaster TRX-2 Protein (1-114 aa), His-SUMO-tagged

• Cat.No.: TRX2-1877D
• Product Overview: Recombinant Drosophila Melanogaster (Fruit fly) TRX-2 Protein (1-114 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.

Specification

• Species: Drosophila
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-114 aa
• Description: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. As a reducing substrate of peroxiredoxin 1, thioredoxin 2 is preferred over thioredoxin 1.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.7 kDa
• AA Sequence: MMILLRDSTNLHFHLQADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Trx-2 thioredoxin-2 [ Drosophila melanogaster (fruit fly) ]
• Official Symbol: TRX-2
• Synonyms: 31884; anon-WO0118547.188; CG31884; CG3864; DmelTrx-2; Dmel\CG31884; dmtrx-2; DmTrx-2; DTrx-2; Trx; trx-2; Trx2; TRX2
• Gene ID: 34281
• mRNA Refseq: NM_164863
• Protein Refseq: NP_723475
• UniProt ID: Q9V429