Recombinant Ebola Virus VP24, His-tagged

Cat.No. : VP24-01V
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : EBOV
Source : E.coli
Tag : His
Form : 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass : Theoretical Mol Wt: ~23kD
AA Sequence : AKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEI ILEFNSSLAI
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage at +4°C. Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VP24 Products

Required fields are marked with *

My Review for All VP24 Products

Required fields are marked with *

0
cart-icon
0
compare icon