Recombinant Enterobacteria Phage 933W STXB2 Protein (20-89 aa), His-tagged

• Cat.No.: STXB2-1611E
• Product Overview: Recombinant Enterobacteria Phage 933W (Bacteriophage 933W) STXB2 Protein (20-89 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Enterobacteria Phage 933W
• Source: Yeast
• Tag: His
• Protein Length: 20-89 aa
• Description: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 9.8 kDa
• AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: stxB2 Shiga toxin 2 subunit B [ Enterobacteria phage 933W ]
• Official Symbol: STXB2
• Synonyms: L0104; sltIIB; stx2B
• Gene ID: 1262010
• Protein Refseq: NP_049501
• UniProt ID: P09386