Recombinant Enterobacteria Phage 933W STXB2 Protein (20-89 aa), His-tagged
Cat.No. : | STXB2-1611E |
Product Overview : | Recombinant Enterobacteria Phage 933W (Bacteriophage 933W) STXB2 Protein (20-89 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria Phage 933W |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-89 aa |
Description : | The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 9.8 kDa |
AA Sequence : | ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | stxB2 Shiga toxin 2 subunit B [ Enterobacteria phage 933W ] |
Official Symbol | STXB2 |
Synonyms | L0104; sltIIB; stx2B; |
Gene ID | 1262010 |
Protein Refseq | NP_049501 |
UniProt ID | P09386 |
◆ Recombinant Proteins | ||
STXB2-942E | Recombinant Enterobacteria Phage 933W STXB2 Protein (20-89 aa), His-SUMO-tagged | +Inquiry |
STXB2-1611E | Recombinant Enterobacteria Phage 933W STXB2 Protein (20-89 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXB2 Products
Required fields are marked with *
My Review for All STXB2 Products
Required fields are marked with *