Recombinant Full Length Arabidopsis Thaliana Alternative Oxidase 4, Chloroplastic/Chromoplastic(Aox4) Protein, His-Tagged
Cat.No. : | RFL15447AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Alternative oxidase 4, chloroplastic/chromoplastic(AOX4) Protein (Q56X52) (57-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (57-351) |
Form : | Lyophilized powder |
AA Sequence : | ATILQDDEEKVVVEESFKAETSTGTEPLEEPNMSSSSTSAFETWIIKLEQGVNVFLTDSV IKILDTLYRDRTYARFFVLETIARVPYFAFMSVLHMYETFGWWRRADYLKVHFAESWNEM HHLLIMEELGGNSWWFDRFLAQHIATFYYFMTVFLYILSPRMAYHFSECVESHAYETYDK FLKASGEELKNMPAPDIAVKYYTGGDLYLFDEFQTSRTPNTRRPVIENLYDVFVNIRDDE AEHCKTMRACQTLGSLRSPHSILEDDDTEEESGCVVPEEAHCEGIVDCLKKSITS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AOX4 |
Synonyms | AOX4; IM; PTOX; At4g22260; T10I14_90; Ubiquinol oxidase 4, chloroplastic/chromoplastic; Alternative oxidase 4; Plastid terminal oxidase; Protein IMMUTANS |
UniProt ID | Q56X52 |
◆ Recombinant Proteins | ||
AOX4-697R | Recombinant Rat AOX4 Protein | +Inquiry |
RFL15447AF | Recombinant Full Length Arabidopsis Thaliana Alternative Oxidase 4, Chloroplastic/Chromoplastic(Aox4) Protein, His-Tagged | +Inquiry |
AOX4-353R | Recombinant Rat AOX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AOX4-594M | Recombinant Mouse AOX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AOX4-1728M | Recombinant Mouse AOX4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AOX4 Products
Required fields are marked with *
My Review for All AOX4 Products
Required fields are marked with *