Recombinant Full Length Bovine Microsomal Glutathione S-Transferase 3(Mgst3) Protein, His-Tagged
| Cat.No. : | RFL21373BF |
| Product Overview : | Recombinant Full Length Bovine Microsomal glutathione S-transferase 3(MGST3) Protein (Q3T100) (1-152aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-152) |
| Form : | Lyophilized powder |
| AA Sequence : | MAVLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRA HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRGALSFI ALIGLMGTTVCSAFQHLGWVRTGLNSGCKSCH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MGST3 |
| Synonyms | MGST3; Microsomal glutathione S-transferase 3; Microsomal GST-3; Glutathione peroxidase MGST3; Microsomal glutathione S-transferase III; Microsomal GST-III |
| UniProt ID | Q3T100 |
| ◆ Recombinant Proteins | ||
| MGST3-2588R | Recombinant Rhesus Macaque MGST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGST3-2767R | Recombinant Rhesus monkey MGST3 Protein, His-tagged | +Inquiry |
| MGST3-9821M | Recombinant Mouse MGST3 Protein | +Inquiry |
| MGST3-5544M | Recombinant Mouse MGST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGST3-12599Z | Recombinant Zebrafish MGST3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGST3-4326HCL | Recombinant Human MGST3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGST3 Products
Required fields are marked with *
My Review for All MGST3 Products
Required fields are marked with *



