Recombinant Full Length Bovine Phosphatidylinositol N-Acetylglucosaminyltransferase Subunit Y(Pigy) Protein, His-Tagged
| Cat.No. : | RFL17198BF |
| Product Overview : | Recombinant Full Length Bovine Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y(PIGY) Protein (P0C1N9) (1-71aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-71) |
| Form : | Lyophilized powder |
| AA Sequence : | MFLSLPMLTVLIPLVSLAGLFYSASVEDDFPQGCTSTTSLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | PIGY |
| Synonyms | PIGY; Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y; Phosphatidylinositol-glycan biosynthesis class Y protein; PIG-Y |
| UniProt ID | P0C1N9 |
| ◆ Recombinant Proteins | ||
| PIGY-5666C | Recombinant Chicken PIGY | +Inquiry |
| PIGY-3247R | Recombinant Rhesus Macaque PIGY Protein, His (Fc)-Avi-tagged | +Inquiry |
| PIGY-12790M | Recombinant Mouse PIGY Protein | +Inquiry |
| RFL299MF | Recombinant Full Length Mouse Phosphatidylinositol N-Acetylglucosaminyltransferase Subunit Y(Pigy) Protein, His-Tagged | +Inquiry |
| PIGY-4456R | Recombinant Rat PIGY Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIGY Products
Required fields are marked with *
My Review for All PIGY Products
Required fields are marked with *



