Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged
| Cat.No. : | RFL29909DF |
| Product Overview : | Recombinant Full Length Danio rerio E3 ubiquitin-protein ligase RNF185(rnf185) Protein (Q6PC78) (1-194aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-194) |
| Form : | Lyophilized powder |
| AA Sequence : | MASAAASESSSSSSSSSAGAANGQSAGESGGGGAQDSTFECNICLDTSKDAVISLCGHLF CWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPE NRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAAPGTPQHTDEQFLSRLF LFVALLIMFWLLIA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | rnf185 |
| Synonyms | rnf185; zgc:73070; E3 ubiquitin-protein ligase RNF185; RING finger protein 185; RING-type E3 ubiquitin transferase RNF185 |
| UniProt ID | Q6PC78 |
| ◆ Recombinant Proteins | ||
| RFL34755HF | Recombinant Full Length Human E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged | +Inquiry |
| RFL25823PF | Recombinant Full Length Pongo Abelii E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged | +Inquiry |
| RNF185-4737R | Recombinant Rat RNF185 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNF185-14325M | Recombinant Mouse RNF185 Protein | +Inquiry |
| Rnf185-5553M | Recombinant Mouse Rnf185 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF185-1523HCL | Recombinant Human RNF185 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All rnf185 Products
Required fields are marked with *
My Review for All rnf185 Products
Required fields are marked with *



