Recombinant Full Length Danio Rerio Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 1(Ergic1) Protein, His-Tagged
Cat.No. : | RFL7563DF |
Product Overview : | Recombinant Full Length Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 1(ergic1) Protein (Q4V8Y6) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MSFDVRRFDIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD PDKDSGGKIDVSLNISLPNLHCDLVGLDIQDEMGRHEVGHIENSMKVPLNNGHGCRFEGE FSINKVPGNFHVSTHSATAQPQSPDMTHIIHKLAFGAKLQVQHVQGAFNALGGADRLQSN ALASHDYILKIVPTVYEELGGKQRFSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRRPFYRFITTICAIIGGTFTVAGIIDSCIFTASEAWKKIQIGKMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ergic1 |
Synonyms | ergic1; ergic32; zgc:114085; Endoplasmic reticulum-Golgi intermediate compartment protein 1; ER-Golgi intermediate compartment 32 kDa protein; ERGIC-32 |
UniProt ID | Q4V8Y6 |
◆ Recombinant Proteins | ||
ERGIC1-3252H | Recombinant Human ERGIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL36472XF | Recombinant Full Length Xenopus Laevis Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 1(Ergic1) Protein, His-Tagged | +Inquiry |
ERGIC1-4580HF | Recombinant Full Length Human ERGIC1 Protein, GST-tagged | +Inquiry |
Ergic1-2857M | Recombinant Mouse Ergic1 Protein, Myc/DDK-tagged | +Inquiry |
ERGIC1-3190Z | Recombinant Zebrafish ERGIC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERGIC1-6558HCL | Recombinant Human ERGIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ergic1 Products
Required fields are marked with *
My Review for All ergic1 Products
Required fields are marked with *