Recombinant Full Length Danio Rerio Inositol Monophosphatase 3(Impad1) Protein, His-Tagged
| Cat.No. : | RFL36145DF |
| Product Overview : | Recombinant Full Length Danio rerio Inositol monophosphatase 3(impad1) Protein (Q2YDR3) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-341) |
| Form : | Lyophilized powder |
| AA Sequence : | MAPMGIRLSPLGIAVFCLLGVGVIYHLYAGVLSSRLAFFRQKRTVDLRELLALSIDAAVQ GGREVKRIREDNTLEEKSKGKTKEGASEKYTLGDLNSHRKMYYLIKNTFPNIQVNSEEHA NAEGEATVWTRMIPEDILAKVSGGKEIPAEKITVWIDPLDATQEYTENLLKYVTTMVCVA VDGEPVIGVIHKPFTGYTVWGFVGEGSNVAPRDSYNTNSPKVIVSRSHAGKVKSFVQTAF GNNTEIIPAGGAGYKALALLNPTDDKQETADIYIHVTYIKKWDICAGDAILKSLGGQMTT LKGEQIDYSGLEGNKGGLLASMKVDHKALVKRLPLWEDNKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | impad1 |
| Synonyms | bpnt2; impa3; impad1; zgc:123256; Inositol monophosphatase 3; IMP 3; IMPase 3; 3'(2', 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Inositol-1(or 4-monophosphatase 3; Myo-inositol monophosphatase A3 |
| UniProt ID | Q2YDR3 |
| ◆ Recombinant Proteins | ||
| Impad1-44M | Recombinant Mouse Impad1 Protein, His-tagged | +Inquiry |
| IMPAD1-2087R | Recombinant Rhesus Macaque IMPAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IMPAD1-2266R | Recombinant Rhesus monkey IMPAD1 Protein, His-tagged | +Inquiry |
| RFL11675SF | Recombinant Full Length Pig Inositol Monophosphatase 3(Impad1) Protein, His-Tagged | +Inquiry |
| RFL26157RF | Recombinant Full Length Rat Inositol Monophosphatase 3(Impad1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IMPAD1-857HCL | Recombinant Human IMPAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All impad1 Products
Required fields are marked with *
My Review for All impad1 Products
Required fields are marked with *



