Recombinant Full Length Danio Rerio Upf0444 Transmembrane Protein C12Orf23 Homolog(Si:Dkey-227K11.2, Zgc:64098) Protein, His-Tagged
| Cat.No. : | RFL18313DF |
| Product Overview : | Recombinant Full Length Danio rerio UPF0444 transmembrane protein C12orf23 homolog(si:dkey-227k11.2, zgc:64098) Protein (Q7T352) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-120) |
| Form : | Lyophilized powder |
| AA Sequence : | MSETNQQRDDLPAYLNDEPPADANKDHPQPQPGMFSRVAGGLFSVTKGAVGATVGGVAWV GGKSFDLTKTAVTSVASVPAMGVGLVKGGVSAVAGGVTAVGSAVVSKVPIGGGKKKDKSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | tmem263 |
| Synonyms | tmem263; si:dkey-227k11.2; zgc:64098; Transmembrane protein 263 |
| UniProt ID | Q7T352 |
| ◆ Recombinant Proteins | ||
| Tmem263-227M | Recombinant Mouse Tmem263 Protein, MYC/DDK-tagged | +Inquiry |
| RFL20750BF | Recombinant Full Length Bovine Upf0444 Transmembrane Protein C12Orf23 Homolog Protein, His-Tagged | +Inquiry |
| TMEM263-12357Z | Recombinant Zebrafish TMEM263 | +Inquiry |
| RFL30572MF | Recombinant Full Length Mouse Upf0444 Transmembrane Protein C12Orf23 Homolog Protein, His-Tagged | +Inquiry |
| TMEM263-5324H | Recombinant Human TMEM263 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All tmem263 Products
Required fields are marked with *
My Review for All tmem263 Products
Required fields are marked with *
