Recombinant Full Length Dog Translocon-Associated Protein Subunit Beta(Ssr2) Protein, His-Tagged
| Cat.No. : | RFL18842CF |
| Product Overview : | Recombinant Full Length Dog Translocon-associated protein subunit beta(SSR2) Protein (P23438) (18-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (18-183) |
| Form : | Lyophilized powder |
| AA Sequence : | EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVTYLAQEDGPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKSKKN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SSR2 |
| Synonyms | SSR2; Translocon-associated protein subunit beta; TRAP-beta; Glycoprotein 25H; gp25H; Signal sequence receptor subunit beta; SSR-beta |
| UniProt ID | P23438 |
| ◆ Recombinant Proteins | ||
| SSR2-1698C | Recombinant Chicken SSR2 | +Inquiry |
| SSR2-4306R | Recombinant Rhesus Macaque SSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SSR2-204Z | Recombinant Zebrafish SSR2 | +Inquiry |
| SSR2-3390H | Recombinant Human SSR2, His-tagged | +Inquiry |
| SSR2-8748M | Recombinant Mouse SSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SSR2-1698HCL | Recombinant Human SSR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSR2 Products
Required fields are marked with *
My Review for All SSR2 Products
Required fields are marked with *



