Recombinant Full Length Human ACO2 Protein, C-Flag-tagged
Cat.No. : | ACO2-1215HFL |
Product Overview : | Recombinant Full Length Human ACO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 82.4 kDa |
AA Sequence : | MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIV YGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDL RRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGG ADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM ATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHIN GPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS EQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFV TSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSP TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKAN SVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLK KQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGS ALNRMKELQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ACO2 aconitase 2 [ Homo sapiens (human) ] |
Official Symbol | ACO2 |
Synonyms | ICRD; OCA8; OPA9; ACONM; HEL-S-284 |
Gene ID | 50 |
mRNA Refseq | NM_001098.3 |
Protein Refseq | NP_001089.1 |
MIM | 100850 |
UniProt ID | Q99798 |
◆ Recombinant Proteins | ||
ACO2-9868Z | Recombinant Zebrafish ACO2 | +Inquiry |
ACO2-111R | Recombinant Rat ACO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACO2-2490H | Recombinant Human ACO2 protein(Gln28-Gln780), His&GST-tagged | +Inquiry |
ACO2-950M | Recombinant Mouse ACO2 Protein, GST & His-tagged | +Inquiry |
ACO2-914H | Recombinant Human ACO2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACO2-440MCL | Recombinant Mouse ACO2 cell lysate | +Inquiry |
ACO2-498HCL | Recombinant Human ACO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACO2 Products
Required fields are marked with *
My Review for All ACO2 Products
Required fields are marked with *
0
Inquiry Basket