Recombinant Full Length Human AKIRIN2 Protein, C-Flag-tagged
Cat.No. : | AKIRIN2-525HFL |
Product Overview : | Recombinant Full Length Human AKIRIN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables enzyme binding activity and identical protein binding activity. Predicted to be involved in positive regulation of innate immune response and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of interleukin-6 production and response to lipopolysaccharide. Located in nucleoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | AKIRIN2 akirin 2 [ Homo sapiens (human) ] |
Official Symbol | AKIRIN2 |
Synonyms | FBI1; C6orf166; dJ486L4.2 |
Gene ID | 55122 |
mRNA Refseq | NM_018064.4 |
Protein Refseq | NP_060534.1 |
MIM | 615165 |
UniProt ID | Q53H80 |
◆ Recombinant Proteins | ||
AKIRIN2-3643H | Recombinant Human AKIRIN2 protein, GST-tagged | +Inquiry |
AKIRIN2-302H | Recombinant Human AKIRIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-3244B | Recombinant Bovine AKIRIN2, His-tagged | +Inquiry |
AKIRIN2-433M | Recombinant Mouse AKIRIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-0011H | Recombinant Human AKIRIN2 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKIRIN2-8934HCL | Recombinant Human AKIRIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKIRIN2 Products
Required fields are marked with *
My Review for All AKIRIN2 Products
Required fields are marked with *
0
Inquiry Basket