Recombinant Full Length Human AVP Protein, C-Flag-tagged
Cat.No. : | AVP-1000HFL |
Product Overview : | Recombinant Full Length Human AVP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTA EALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAG ALLLRLVQLAGAPEPFEPAQPDAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | AVP arginine vasopressin [ Homo sapiens (human) ] |
Official Symbol | AVP |
Synonyms | VP; ADH; ARVP; AVRP; AVP-NPII |
Gene ID | 551 |
mRNA Refseq | NM_000490.5 |
Protein Refseq | NP_000481.2 |
MIM | 192340 |
UniProt ID | P01185 |
◆ Recombinant Proteins | ||
AVP-1043H | Recombinant Human AVP protein, GST-tagged | +Inquiry |
AVP-3033H | Recombinant Human AVP Protein, MYC/DDK-tagged | +Inquiry |
AVP-1313H | Recombinant Human AVP Protein (Cys20-Tyr164), N-His tagged | +Inquiry |
AVP-912M | Recombinant Mouse AVP Protein, His (Fc)-Avi-tagged | +Inquiry |
AVP-2213M | Recombinant Mouse AVP Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AVP Products
Required fields are marked with *
My Review for All AVP Products
Required fields are marked with *