Recombinant Full Length Human BSND Protein, GST-tagged
| Cat.No. : | BSND-3829HF |
| Product Overview : | Human BSND full-length ORF (1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 320 amino acids |
| Description : | This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 61.6 kDa |
| AA Sequence : | MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BSND Bartter syndrome, infantile, with sensorineural deafness (Barttin) [ Homo sapiens ] |
| Official Symbol | BSND |
| Synonyms | BSND; Bartter syndrome, infantile, with sensorineural deafness (Barttin); deafness, autosomal recessive 73 , DFNB73; barttin; BART; deafness, autosomal recessive 73; DFNB73; MGC119283; MGC119284; MGC119285; |
| Gene ID | 7809 |
| mRNA Refseq | NM_057176 |
| Protein Refseq | NP_476517 |
| MIM | 606412 |
| UniProt ID | Q8WZ55 |
| ◆ Recombinant Proteins | ||
| BSND-10305H | Recombinant Human BSND, GST-tagged | +Inquiry |
| BSND-1099M | Recombinant Mouse BSND Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSND-681R | Recombinant Rat BSND Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSND-3829HF | Recombinant Full Length Human BSND Protein, GST-tagged | +Inquiry |
| BSND-1023R | Recombinant Rat BSND Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BSND-8401HCL | Recombinant Human BSND 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSND Products
Required fields are marked with *
My Review for All BSND Products
Required fields are marked with *



