Recombinant Full Length Human BSND Protein, GST-tagged

Cat.No. : BSND-3829HF
Product Overview : Human BSND full-length ORF (1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 320 amino acids
Description : This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 61.6 kDa
AA Sequence : MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BSND Bartter syndrome, infantile, with sensorineural deafness (Barttin) [ Homo sapiens ]
Official Symbol BSND
Synonyms BSND; Bartter syndrome, infantile, with sensorineural deafness (Barttin); deafness, autosomal recessive 73 , DFNB73; barttin; BART; deafness, autosomal recessive 73; DFNB73; MGC119283; MGC119284; MGC119285;
Gene ID 7809
mRNA Refseq NM_057176
Protein Refseq NP_476517
MIM 606412
UniProt ID Q8WZ55

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BSND Products

Required fields are marked with *

My Review for All BSND Products

Required fields are marked with *

0

Inquiry Basket

cartIcon