Recombinant Full Length Human C11orf65 Protein, GST-tagged
| Cat.No. : | C11orf65-1845HF |
| Product Overview : | Human C11orf65 full-length ORF ( AAH59411.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 313 amino acids |
| Description : | Predicted to be involved in negative regulation of mitochondrial fission and negative regulation of protein targeting to mitochondrion. Predicted to be located in cytosol and mitochondrial outer membrane. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 63 kDa |
| AA Sequence : | MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIELMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNLDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf65 chromosome 11 open reading frame 65 [ Homo sapiens ] |
| Official Symbol | C11orf65 |
| Synonyms | C11ORF65; chromosome 11 open reading frame 65; uncharacterized protein C11orf65; MGC33948 |
| Gene ID | 160140 |
| mRNA Refseq | NM_152587 |
| Protein Refseq | NP_689800 |
| UniProt ID | Q8NCR3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf65 Products
Required fields are marked with *
My Review for All C11orf65 Products
Required fields are marked with *



