Recombinant Full Length Human C3orf22 Protein, GST-tagged

Cat.No. : C3orf22-2612HF
Product Overview : Human C3orf22 full-length ORF (NP_689746.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 141 amino acids
Description : C3orf22 (Chromosome 3 Open Reading Frame 22) is a Protein Coding gene.
Molecular Mass : 42.1 kDa
AA Sequence : MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C3orf22 chromosome 3 open reading frame 22 [ Homo sapiens (human) ]
Official Symbol C3orf22
Synonyms C3orf22; chromosome 3 open reading frame 22; uncharacterized protein C3orf22;
Gene ID 152065
mRNA Refseq NM_152533
Protein Refseq NP_689746
UniProt ID Q8N5N4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3orf22 Products

Required fields are marked with *

My Review for All C3orf22 Products

Required fields are marked with *

0
cart-icon