Recombinant Full Length Human C3orf22 Protein, GST-tagged
| Cat.No. : | C3orf22-2612HF | 
| Product Overview : | Human C3orf22 full-length ORF (NP_689746.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 141 amino acids | 
| Description : | C3orf22 (Chromosome 3 Open Reading Frame 22) is a Protein Coding gene. | 
| Molecular Mass : | 42.1 kDa | 
| AA Sequence : | MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C3orf22 chromosome 3 open reading frame 22 [ Homo sapiens (human) ] | 
| Official Symbol | C3orf22 | 
| Synonyms | C3orf22; chromosome 3 open reading frame 22; uncharacterized protein C3orf22; | 
| Gene ID | 152065 | 
| mRNA Refseq | NM_152533 | 
| Protein Refseq | NP_689746 | 
| UniProt ID | Q8N5N4 | 
| ◆ Recombinant Proteins | ||
| C3orf22-2612HF | Recombinant Full Length Human C3orf22 Protein, GST-tagged | +Inquiry | 
| C3orf22-0018H | Recombinant Human C3orf22 Protein, GST-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C3orf22-8051HCL | Recombinant Human C3orf22 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3orf22 Products
Required fields are marked with *
My Review for All C3orf22 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            