Recombinant Full Length Human C5orf24 Protein, GST-tagged
| Cat.No. : | C5orf24-2664HF |
| Product Overview : | Human C5orf24 full-length ORF (NP_689622.2, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 188 amino acids |
| Description : | C5orf24 (Chromosome 5 Open Reading Frame 24) is a Protein Coding gene. |
| Molecular Mass : | 46.5 kDa |
| AA Sequence : | MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C5orf24 chromosome 5 open reading frame 24 [ Homo sapiens ] |
| Official Symbol | C5orf24 |
| Synonyms | C5ORF24; chromosome 5 open reading frame 24; UPF0461 protein C5orf24; FLJ37562; |
| Gene ID | 134553 |
| mRNA Refseq | NM_001135586 |
| Protein Refseq | NP_001129058 |
| UniProt ID | Q7Z6I8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf24 Products
Required fields are marked with *
My Review for All C5orf24 Products
Required fields are marked with *
