Recombinant Full Length Human CCDC134 Protein, GST-tagged
Cat.No. : | CCDC134-2837HF |
Product Overview : | Human CCDC134 full-length ORF (BAB15315.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 229 amino acids |
Description : | CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene. |
Molecular Mass : | 53 kDa |
AA Sequence : | MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC134 coiled-coil domain containing 134 [ Homo sapiens ] |
Official Symbol | CCDC134 |
Synonyms | dJ821D11.3 |
Gene ID | 79879 |
mRNA Refseq | NM_024821 |
Protein Refseq | NP_079097 |
UniProt ID | Q9H6E4 |
◆ Recombinant Proteins | ||
CCDC134-1350H | Recombinant Human CCDC134 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC134-2767H | Recombinant Human CCDC134 Protein, MYC/DDK-tagged | +Inquiry |
CCDC134-1174R | Recombinant Rat CCDC134 Protein | +Inquiry |
CCDC134-832R | Recombinant Rat CCDC134 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccdc134-1991M | Recombinant Mouse Ccdc134 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC134-1685HCL | Recombinant Human CCDC134 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC134 Products
Required fields are marked with *
My Review for All CCDC134 Products
Required fields are marked with *
0
Inquiry Basket