Recombinant Full Length Human CCDC134 Protein, GST-tagged

• Cat.No.: CCDC134-2837HF
• Product Overview: Human CCDC134 full-length ORF (BAB15315.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 229 amino acids
• Description: CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene.
• Molecular Mass: 53 kDa
• AA Sequence: MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC134 coiled-coil domain containing 134 [ Homo sapiens ]
• Official Symbol: CCDC134
• Synonyms: dJ821D11.3
• Gene ID: 79879
• mRNA Refseq: NM_024821
• Protein Refseq: NP_079097
• UniProt ID: Q9H6E4