Recombinant Full Length Human CEBPG Protein, GST-tagged

• Cat.No.: CEBPG-3281HF
• Product Overview: Human CEBPG full-length ORF (AAH13128, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 150 amino acids
• Description: The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]
• Molecular Mass: 42.24 kDa
• AA Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ]
• Official Symbol: CEBPG
• Synonyms: CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer-binding protein gamma; GPE1BP; IG/EBP 1; c/EBP gamma; IG/EBP-1
• Gene ID: 1054
• mRNA Refseq: NM_001252296
• Protein Refseq: NP_001239225
• MIM: 138972
• UniProt ID: P53567