Recombinant Full Length Human CHAC1 Protein, C-Flag-tagged
Cat.No. : | CHAC1-431HFL |
Product Overview : | Recombinant Full Length Human CHAC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.2 kDa |
AA Sequence : | MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTF HRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKA LAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLP CFCPTEQALALVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CHAC1 ChaC glutathione specific gamma-glutamylcyclotransferase 1 [ Homo sapiens (human) ] |
Official Symbol | CHAC1 |
Synonyms | MGC4504 |
Gene ID | 79094 |
mRNA Refseq | NM_024111.6 |
Protein Refseq | NP_077016.3 |
MIM | 614587 |
UniProt ID | Q9BUX1 |
◆ Recombinant Proteins | ||
CHAC1-589H | Recombinant Human CHAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHAC1-1361R | Recombinant Rat CHAC1 Protein | +Inquiry |
CHAC1-431HFL | Recombinant Full Length Human CHAC1 Protein, C-Flag-tagged | +Inquiry |
CHAC1-5990H | Recombinant Human CHAC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHAC1-4446C | Recombinant Chicken CHAC1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAC1 Products
Required fields are marked with *
My Review for All CHAC1 Products
Required fields are marked with *