Recombinant Full Length Human CHD2 Protein

Cat.No. : CHD2-74HF
Product Overview : Recombinant full length Human CHD2 with an N terminal proprietary tag; Predicted MWt 81.22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 81.220kDa inclusive of tags
Protein Length : 501 amino acids
AA Sequence : MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESE QGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLP EAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPS RFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQ EQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRG KRKKQDSSDEDDDDDEAPKRQTRRRAAKNVSYKEDDDFET DSDDLIEMTGEGVDEQQDNSETIEKVLDSRLGKKGATGAS TTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHST WESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDV EYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPA HSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKKFQNC IDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGE NLELRDYQLEGLNWLAHSWCK
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CHD2 chromodomain helicase DNA binding protein 2 [ Homo sapiens ]
Official Symbol : CHD2
Synonyms : CHD2; chromodomain helicase DNA binding protein 2; chromodomain-helicase-DNA-binding protein 2; DKFZp547I1315; DKFZp686E01200; DKFZp781D1727; FLJ38614
Gene ID : 1106
mRNA Refseq : NM_001042572
Protein Refseq : NP_001036037
MIM : 602119
UniProt ID : O14647

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CHD2 Products

Required fields are marked with *

My Review for All CHD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends