Recombinant Full Length Human CHMP1B Protein, GST-tagged

• Cat.No.: CHMP1B-3204HF
• Product Overview: Human CHMP1B full-length ORF (NP_065145.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 199 amino acids
• Description: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 48.5 kDa
• AA Sequence: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHMP1B charged multivesicular body protein 1B [ Homo sapiens ]
• Official Symbol: CHMP1B
• Synonyms: CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2
• Gene ID: 57132
• mRNA Refseq: NM_020412
• Protein Refseq: NP_065145
• MIM: 606486
• UniProt ID: Q7LBR1